Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSQTSPLSEQADSSLKYDYSNVPAQALDAIRMRLAQLTHSLSKIRDDMSKADLPQWYSLQAQLSVTLTQLSSLTSTLQHFEDTLECTVPYPLPSFPTTAHEGLLTTLMRKKQIPEVENWIKDAIDHSGLDLEGRNWDEIESAIQRDKSTTARALDFINQEYSNYSFQGLYTAEELSKNVGDPQSMIYRSATSNAKPKAPFSVDSILTFMYQGTMKTEETSIAK |
Length | 223 |
Position | Head |
Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Eremothecium. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.516 |
Instability index | 47.56 |
Isoelectric point | 4.92 |
Molecular weight | 25087.80 |
Publications | PubMed=15001715 PubMed=23749448 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | protein-macromolecule adaptor activity GO:0030674 IEA:EnsemblFungi RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IBA:GO_Central TBP-class protein binding GO:0017025 IEA:EnsemblFungi transcription coregulator activity GO:0003712 IBA:GO_Central transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31814 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.04| 34| 37| 19| 54| 1 --------------------------------------------------------------------------- 10- 49 (39.17/29.74) QADssLKydYSnVPAQaLDAIRMRLAQLTHSLSKIRDDMS 50- 85 (51.87/30.07) KAD..LPqwYS.LQAQ.LSVTLTQLSSLTSTLQHFEDTLE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 135.46| 41| 41| 134| 174| 2 --------------------------------------------------------------------------- 134- 174 (69.86/38.18) RNWDEIESAIQRDKSTTAR.ALDFINQEYSNYSFQGLYTAEE 177- 218 (65.60/35.53) KNVGDPQSMIYRSATSNAKpKAPFSVDSILTFMYQGTMKTEE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MIYRSA 2) SLKYDY | 185 14 | 190 19 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab