<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31806
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MEPNEGVQLFSAFPPPPPYYKLFTRENIEKVISNMEKEAKHEDDANTLQPKTEEEIESLAKLFKKPSCLTSGTYQMFGDTWRLDEAIPSLKEFGIPELYKDIKDGEDEIEVVEYDPKSNAIVGTSFTRVHDYDKNSPIENEKILEDDQHTAMKEKDNESDKTMKDVEEKTEPSLKKEEEDIQMKEPLDSQDTGAVSASSVNEGFRADQKSKDGETSDLIKIPRRAYELRFLSRSLMLNFLELLGIMAKAPEQFPSKVENIRVLLLNLHHLINDYRPHQSRESLIMLLEKQLKHEESQVELLRTHNRQMTETLEKYKSLDFNMEKEGDVIQQLKSSIKKPLSGAEDEQKSRSMFSKNDEKLKKSLELMEDVIKRDLS |
| Length | 376 |
| Position | Middle |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae>
Schizosaccharomyces.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.886 |
| Instability index | 48.36 |
| Isoelectric point | 4.97 |
| Molecular weight | 43508.59 |
| Publications | PubMed=11859360
PubMed=10759889
PubMed=10625684
PubMed=11572939
PubMed=16630887
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
euchromatin GO:0000791 IDA:PomBase
mediator complex GO:0016592 IDA:PomBase
nucleus GO:0005634 HDA:PomBase
P:positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IPomBase
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IDA:PomBase
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IC:PomBase
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31806
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.87| 21| 38| 321| 341| 1
---------------------------------------------------------------------------
321- 341 (34.54/21.75) NMEKEGDVIQQLKSSIKKPLS
356- 376 (33.33/20.74) NDEKLKKSLELMEDVIKRDLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.75| 20| 38| 242| 261| 2
---------------------------------------------------------------------------
242- 261 (30.30/16.37) LLGIMAKAPEQFPSKVENIR
263- 282 (29.38/15.68) LLLNLHHLINDYRPHQSRES
283- 302 (28.08/14.71) LIMLLEKQLKHEESQVELLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.01| 35| 111| 2| 61| 3
---------------------------------------------------------------------------
23- 61 (50.91/63.00) FTR..........ENiEKVISNMEKEAKHEDD......ANTLQPKTEEeieSLAK
126- 176 (47.10/15.19) FTRvhdydknspiEN.EKILEDDQHTAMKEKDnesdktMKDVEEKTEP...SLKK
---------------------------------------------------------------------------
|