Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEPNEGVQLFSAFPPPPPYYKLFTRENIEKVISNMEKEAKHEDDANTLQPKTEEEIESLAKLFKKPSCLTSGTYQMFGDTWRLDEAIPSLKEFGIPELYKDIKDGEDEIEVVEYDPKSNAIVGTSFTRVHDYDKNSPIENEKILEDDQHTAMKEKDNESDKTMKDVEEKTEPSLKKEEEDIQMKEPLDSQDTGAVSASSVNEGFRADQKSKDGETSDLIKIPRRAYELRFLSRSLMLNFLELLGIMAKAPEQFPSKVENIRVLLLNLHHLINDYRPHQSRESLIMLLEKQLKHEESQVELLRTHNRQMTETLEKYKSLDFNMEKEGDVIQQLKSSIKKPLSGAEDEQKSRSMFSKNDEKLKKSLELMEDVIKRDLS |
Length | 376 |
Position | Middle |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae> Schizosaccharomyces. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.886 |
Instability index | 48.36 |
Isoelectric point | 4.97 |
Molecular weight | 43508.59 |
Publications | PubMed=11859360 PubMed=10759889 PubMed=10625684 PubMed=11572939 PubMed=16630887 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central euchromatin GO:0000791 IDA:PomBase mediator complex GO:0016592 IDA:PomBase nucleus GO:0005634 HDA:PomBase P:positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IPomBase |
GO - Biological Function | transcription coactivator activity GO:0003713 IDA:PomBase |
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IC:PomBase regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31806 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.87| 21| 38| 321| 341| 1 --------------------------------------------------------------------------- 321- 341 (34.54/21.75) NMEKEGDVIQQLKSSIKKPLS 356- 376 (33.33/20.74) NDEKLKKSLELMEDVIKRDLS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 87.75| 20| 38| 242| 261| 2 --------------------------------------------------------------------------- 242- 261 (30.30/16.37) LLGIMAKAPEQFPSKVENIR 263- 282 (29.38/15.68) LLLNLHHLINDYRPHQSRES 283- 302 (28.08/14.71) LIMLLEKQLKHEESQVELLR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 98.01| 35| 111| 2| 61| 3 --------------------------------------------------------------------------- 23- 61 (50.91/63.00) FTR..........ENiEKVISNMEKEAKHEDD......ANTLQPKTEEeieSLAK 126- 176 (47.10/15.19) FTRvhdydknspiEN.EKILEDDQHTAMKEKDnesdktMKDVEEKTEP...SLKK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PPYYKLFTRENIEKVISNME 2) VQLFSAF | 17 7 | 36 13 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab