<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31804
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSTANGDLISSLYPPPPVYVKFFTTENLNKLQEWQRQQNDEEIETKQEEADDKDEKDNEKQNETQDTVPPGELRFLVPPQPPSGTHYRGYGNIWSFEDKLPSLKSANWEQLYKDDDESITSETKIKELHKLMDSLLLNFLELIGLASIDPSQYESKIKDISLILININHLLNTYRPHQSRESLIMLLRKQIDAKRASINQVEKVCSEVKQKLLKLTNIQDVYKKDSIVLPDNSDNSPMAENAESIKDEIIKKLLSEH |
Length | 257 |
Position | Middle |
Organism | Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Scheffersomyces.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.777 |
Instability index | 51.07 |
Isoelectric point | 4.94 |
Molecular weight | 29653.05 |
Publications | PubMed=17334359
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP31804
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 171.50| 53| 62| 6| 65| 1
---------------------------------------------------------------------------
6- 65 (79.27/66.70) GDLiSSLYPP.PPVYVKFFTTENLnklqeWQRQQNDEEIETKQEEADDKDEkDNEKQNETQ
71- 124 (92.23/57.26) GEL.RFLVPPqPPSGTHYRGYGNI.....WSFEDKLPSLKSANWEQLYKDD.DESITSETK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.99| 21| 26| 135| 157| 2
---------------------------------------------------------------------------
135- 157 (30.51/24.95) LLLNFLELigLASIDPSQ.YESKI
163- 184 (33.48/20.48) ILININHL..LNTYRPHQsRESLI
---------------------------------------------------------------------------
|