| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAEAGQPRPLTAFAPPPPLWKHFTPDNLKRLEEVKKEASKGEDGKPRKKKWTPAELRALQLPPELRFLVPPEIPMSGQYSVFGELQSLSTTLPSLQEQGIEQLYPSTPTETDPNKPSQPSRPFNHAYYLLKISKSLLLNFLEFVGILSITPEQFQSKVEDLRNLFINAHHLLNLYRPHQARESLIMMMEEQLNRSREEIQQMDKMHAEINGFLEQLKAQGIDVDSASKSGENDTAKRTTGDQDANNANSSRLVWDILDGTD |
| Length | 261 |
| Position | Middle |
| Organism | Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.691 |
| Instability index | 59.04 |
| Isoelectric point | 5.62 |
| Molecular weight | 29613.19 |
| Publications | PubMed=18404212 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP31801 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) PLWKHFTPDNLKRLEEVKKEASKGEDGKPRKKKWTPAELRALQLPPELR 2) SRLVWDILDGT | 18 250 | 66 260 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab