Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP |
Length | 233 |
Position | Middle |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.736 |
Instability index | 49.11 |
Isoelectric point | 5.50 |
Molecular weight | 27244.94 |
Publications | PubMed=9671713 PubMed=9989412 PubMed=15489334 PubMed=10235267 PubMed=15175163 PubMed=15989967 PubMed=17709345 PubMed=19369195 PubMed=25218447 PubMed=25114211 PubMed=25772364 PubMed=25755297 PubMed=28112733 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central nuclear body GO:0016604 IDA:HPA nucleoplasm GO:0005654 TAS:Reactome transcription regulator complex GO:0005667 IDA:MGI ubiquitin ligase complex GO:0000151 IEA:Ensembl |
GO - Biological Function | transcription coactivator activity GO:0003713 TAS:ProtInc ubiquitin protein ligase activity GO:0061630 IEA:Ensembl |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IDA:MGI regulation of transcription initiation from RNA polymerase II promoter GO:0060260 TAS:Reactome stem cell population maintenance GO:0019827 IEA:Ensembl transcription initiation from RNA polymerase II promoter GO:0006367 TAS:ProtInc |
Binary Interactions | [O43513<-->Q9Y376: CAB39] NbExp=3 EBI-394632,EBI-306905 [O43513<-->A0A0S2Z4Q4: HGS] NbExp=3 EBI-394632,EBI-16429135 [O43513<-->O14964: HGS] NbExp=4 EBI-394632,EBI-740220 [O43513<-->Q15648: MED1] NbExp=6 EBI-394632,EBI-394459 [O43513<-->Q9BTT4: MED10] NbExp=7 EBI-394632,EBI-394354 [O43513<-->Q13503: MED21] NbExp=3 EBI-394632,EBI-394678 [O43513<-->O95402: MED26] NbExp=8 EBI-394632,EBI-394392 [O43513<-->Q9Y3C7: MED31] NbExp=3 EBI-394632,EBI-394707 [O43513<-->P03383: env] Xeno NbExp=3, |
Repeats | >MDP31798 No repeats found |
Disease |
MoRF Sequence | Start | Stop |
1) PMQYIKEYTD | 14 | 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab