<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31796
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSNQETQVSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIPIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMMEMQKRQRVETAARFQKHLERVREIVNTAFSALPVLDDDDDSGGAKIKTEVDPLEANAAAKNDPSYQHDRMLCKLVDAIE |
Length | 220 |
Position | Middle |
Organism | Drosophila melanogaster (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.695 |
Instability index | 49.89 |
Isoelectric point | 6.26 |
Molecular weight | 25707.01 |
Publications | PubMed=10731132
PubMed=12537572
PubMed=15477388
PubMed=16751183
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity). Required for
activated transcription of the MtnA, MtnB and MtnD genes.
ECO:0000250
ECO:0000269 PubMed:16751183
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 ISS:FlyBase
|
GO - Biological Function | transcription coregulator activity GO:0003712 IMP:UniProtKB
|
GO - Biological Process | F:transcription coregulator activity GO:0003712 IMUniProtKB
regulation of transcription by RNA polymerase II GO:0006357 IMUniProtKB
|
Interaction
Repeat regions
Repeats |
>MDP31796
No repeats found
No repeats found
|