<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31794
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MTSTNEDIISSLYPPPPPYFKYFTEQNLNNLEIWKNKAQDEMQIDKTDLEQVKEDQDIKPPGELKFLVPPKQPDADHYRGFGNLWSFEDKLPGLKESGWTQLYKDDDELITSNTKIDELHKLMDSLLLNFLELIGVVSIDPQQFHYKIEDLKLILININHILNTYRPHQSRESLIMLLRKQIDMKRNEISEIDKTSEDIKSKILKLVDTSYIGDQEDAKCDNDSTEDEESIKNNIIQKLLNQNV |
| Length | 244 |
| Position | Middle |
| Organism | Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Debaryomyces.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.731 |
| Instability index | 49.75 |
| Isoelectric point | 4.70 |
| Molecular weight | 28508.87 |
| Publications | PubMed=15229592
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP31794
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.71| 18| 42| 45| 64| 2
---------------------------------------------------------------------------
45- 64 (27.75/22.96) DKtdLEQVKED...QDIKPPGEL
89- 109 (26.96/15.23) DK..LPGLKESgwtQLYKDDDEL
---------------------------------------------------------------------------
|