| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MTSTNEDIISSLYPPPPPYFKYFTEQNLNNLEIWKNKAQDEMQIDKTDLEQVKEDQDIKPPGELKFLVPPKQPDADHYRGFGNLWSFEDKLPGLKESGWTQLYKDDDELITSNTKIDELHKLMDSLLLNFLELIGVVSIDPQQFHYKIEDLKLILININHILNTYRPHQSRESLIMLLRKQIDMKRNEISEIDKTSEDIKSKILKLVDTSYIGDQEDAKCDNDSTEDEESIKNNIIQKLLNQNV |
| Length | 244 |
| Position | Middle |
| Organism | Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Debaryomyces. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.731 |
| Instability index | 49.75 |
| Isoelectric point | 4.70 |
| Molecular weight | 28508.87 |
| Publications | PubMed=15229592 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats |
>MDP31794
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.71| 18| 42| 45| 64| 2
---------------------------------------------------------------------------
45- 64 (27.75/22.96) DKtdLEQVKED...QDIKPPGEL
89- 109 (26.96/15.23) DK..LPGLKESgwtQLYKDDDEL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IISSLY 2) PPYFKYFTEQNLN | 8 17 | 13 29 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab