Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MTSTNEDIISSLYPPPPPYFKYFTEQNLNNLEIWKNKAQDEMQIDKTDLEQVKEDQDIKPPGELKFLVPPKQPDADHYRGFGNLWSFEDKLPGLKESGWTQLYKDDDELITSNTKIDELHKLMDSLLLNFLELIGVVSIDPQQFHYKIEDLKLILININHILNTYRPHQSRESLIMLLRKQIDMKRNEISEIDKTSEDIKSKILKLVDTSYIGDQEDAKCDNDSTEDEESIKNNIIQKLLNQNV |
Length | 244 |
Position | Middle |
Organism | Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Debaryomyces. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.731 |
Instability index | 49.75 |
Isoelectric point | 4.70 |
Molecular weight | 28508.87 |
Publications | PubMed=15229592 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP31794 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.71| 18| 42| 45| 64| 2 --------------------------------------------------------------------------- 45- 64 (27.75/22.96) DKtdLEQVKED...QDIKPPGEL 89- 109 (26.96/15.23) DK..LPGLKESgwtQLYKDDDEL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IISSLY 2) PPYFKYFTEQNLN | 8 17 | 13 29 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab