Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEEGGQQKGITAAFPPPPPFWKKFTPENLERLEKAKREAEPQALSRKWSPEALHALKLAPELRYLVPPELPKEGSYSLFGEAQSLSTQLPSLEEQGIEQLYPSSLTNETAGPSPDHAYYLLKISKSLLLNFLELVGILSINPEQYEPKIEDIRNLFINAHHLLNLYRPHQSRESLITMMEEQLEQAKEEIREMEQTKERVEIYLRELEAEGRNVSPNDEPVQTPESGPHNTKTQTSESQANGEQVLWKLLDKVEES |
Length | 256 |
Position | Middle |
Organism | Coccidioides immitis (strain RS) (Valley fever fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.760 |
Instability index | 60.03 |
Isoelectric point | 4.91 |
Molecular weight | 29249.56 |
Publications | PubMed=19717792 PubMed=20516208 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31791 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 126.55| 39| 39| 22| 60| 1 --------------------------------------------------------------------------- 22- 60 (65.02/36.18) KKFTPENLERLEKAKREAEPQALSRKW.SPEALHALKLAP 63- 102 (61.53/33.87) RYLVPPELPKEGSYSLFGEAQSLSTQLpSLEEQGIEQLYP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.44| 23| 32| 108| 131| 2 --------------------------------------------------------------------------- 108- 131 (35.30/31.71) ETAGPSPDHAYYLLkISKSLLLNF 143- 165 (40.15/30.64) EQYEPKIEDIRNLF.INAHHLLNL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GEQVLWKLLDKVEES 2) PFWKKFTPENLER | 242 19 | 256 31 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab