<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31789

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMSREESVSGANDVSSLYPPPPPYIKYFTSENVEKLKEYNERREEGESAENELDFLIPPPMPSSGSYRAFGSVWQIKDHLPDLETMGITQLYKKTSEGEAEVTDYQYKIKELRRLSYSLLLNFVELVGVLSVNPELYESKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEHKKQEVANIELVCQQVTEKLKQVQTLLKESQSQSQSQSQSQSQSQSQSQLQSDSQ
Length230
PositionMiddle
OrganismCandida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Nakaseomyces> Nakaseomyces/Candida clade.
Aromaticity0.07
Grand average of hydropathy-0.746
Instability index77.97
Isoelectric point4.97
Molecular weight26511.31
Publications
PubMed=15229592

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31789
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     128.35|      36|      37|       3|      38|       1
---------------------------------------------------------------------------
    3-   38 (65.62/39.64)	REESVSGANDVSSLYPPP.PPYIKYFTSENVEKLKEY
   42-   78 (62.73/37.63)	REEGESAENELDFLIPPPmPSSGSYRAFGSVWQIKDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.23|      14|      14|     160|     173|       2
---------------------------------------------------------------------------
  160-  173 (23.78/13.04)	HQSRE.SLIMLLEEQ
  176-  190 (19.45/ 9.64)	HKKQEvANIELVCQQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31789 with Med7 domain of Kingdom Fungi

Unable to open file!