<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31787
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MLPGFGAQTVSPFPNPPEYASAYTSDRINNGSAPPPPHPLTEFKVYGEEYRLEDDVIAPLKNAGVAELYKNKNNWKTEMKKLNRSAIVAFFDLVEILIRAPDHPMREEKMVDLHTIFINMHHLINEFRPVQARDSVRILQERQIEELSDICKDFKKYLRDGREVVDDQFQMIRGKLPAPPQPSELTRVKLQDGVLHMLQETEASDDVEMKEEEGSEYSKKKARLELLSREDGPPSVVHLLARQFHDISLKK |
Length | 251 |
Position | Middle |
Organism | Caenorhabditis elegans |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.642 |
Instability index | 50.58 |
Isoelectric point | 5.69 |
Molecular weight | 28887.62 |
Publications | PubMed=9851916
PubMed=10611325
PubMed=11728440
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity). Required for
germ cell development and gonadal growth.
ECO:0000250
ECO:0000269 PubMed:10611325
ECO:0000269 PubMed:11728440
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | embryo development ending in birth or egg hatching GO:0009792 IGI:WormBase
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
reproduction GO:0000003 IMWormBase
|
Interaction
Repeat regions
Repeats |
>MDP31787
No repeats found
|