<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31786

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMLPGFGATQTVSPFPNPPEYASAYTSDRIDNGSAPPPPHPLTEFKVFGEEYRLEEDVIAPLSTAGVEQYYVDKNNWKAEMKKLNRXIGAFFDLLEVLIRAPDHPARDKKMVDLHTIFINMHHLINEFRPVQARDSVRILQERQIDELTEICDDFREYLAHGREVVEDQFKMITGKLPPPPPPSDLTRVRMQNGALHRLIEVEKETEEDEEMKEDDEEKPSTSSSEGNQKTLRDMTKGHGPPSVVNLLARQLNEMELKK
Length258
PositionMiddle
OrganismCaenorhabditis briggsae
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.07
Grand average of hydropathy-0.740
Instability index45.78
Isoelectric point5.03
Molecular weight29416.88
Publications
PubMed=14624247

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
embryo development ending in birth or egg hatching	GO:0009792	IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central
reproduction	GO:0000003	IEA:EnsemblMetazoa

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31786
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      87.03|      21|     141|      35|      55|       1
---------------------------------------------------------------------------
   13-   31 (20.25/ 6.49)	.PFPNP.PEY...ASAYtsdRIDN
   35-   55 (39.94/18.08)	PPPPHPLTEFKVFGEEY...RLEE
   60-   79 (26.83/10.36)	PLSTAGVEQYYVDKNNW...KAE.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31786 with Med7 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QFKMITGKLPPPPPPSDLTRVRMQNGALHRLIEVEKETEEDEEMKEDDEEKPSTSSSEGNQKTLRDMTKGHGPPSVVNLLARQLN
168
252










Molecular Recognition Features






MoRF SequenceStartStop




NANANA