<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31786
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MLPGFGATQTVSPFPNPPEYASAYTSDRIDNGSAPPPPHPLTEFKVFGEEYRLEEDVIAPLSTAGVEQYYVDKNNWKAEMKKLNRXIGAFFDLLEVLIRAPDHPARDKKMVDLHTIFINMHHLINEFRPVQARDSVRILQERQIDELTEICDDFREYLAHGREVVEDQFKMITGKLPPPPPPSDLTRVRMQNGALHRLIEVEKETEEDEEMKEDDEEKPSTSSSEGNQKTLRDMTKGHGPPSVVNLLARQLNEMELKK |
| Length | 258 |
| Position | Middle |
| Organism | Caenorhabditis briggsae |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.740 |
| Instability index | 45.78 |
| Isoelectric point | 5.03 |
| Molecular weight | 29416.88 |
| Publications | PubMed=14624247
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | embryo development ending in birth or egg hatching GO:0009792 IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
reproduction GO:0000003 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP31786
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.03| 21| 141| 35| 55| 1
---------------------------------------------------------------------------
13- 31 (20.25/ 6.49) .PFPNP.PEY...ASAYtsdRIDN
35- 55 (39.94/18.08) PPPPHPLTEFKVFGEEY...RLEE
60- 79 (26.83/10.36) PLSTAGVEQYYVDKNNW...KAE.
---------------------------------------------------------------------------
|