<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31778
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSDSNNISSLYPPPPPYVKFFTKDNLERLAEYQSSHVTTDPEQITCELDFLIPPPVPSAGHYRAFGSVWQVKDELPDLETVGLRNLYDDRGQHGNNYQYKIKELHKLLKSLLLNMLELVSVLSVNPERFPDKVEHIRTILFNIHHLLNEYRPHQSRESLIMLLEEQLEHKKEEIANIHAICDKVQAKLAAMCKQYIADD |
| Length | 199 |
| Position | Middle |
| Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.476 |
| Instability index | 49.95 |
| Isoelectric point | 5.67 |
| Molecular weight | 23075.06 |
| Publications | PubMed=15001715
PubMed=23749448
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31778
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.30| 14| 37| 131| 144| 1
---------------------------------------------------------------------------
131- 144 (25.33/15.70) DKVEHIRTILFNIH
165- 178 (22.98/13.75) EQLEHKKEEIANIH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.63| 13| 27| 66| 78| 3
---------------------------------------------------------------------------
66- 78 (24.56/13.48) GSVWQVK.DELPDL
94- 107 (20.07/10.06) GNNYQYKiKELHKL
---------------------------------------------------------------------------
|