<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31772
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSTQPAPPPEAPSNLLHVQFKNPEFLSYLSHLQSTGQVSLGRDSSCAKFDPAHPLTEHNVMAYFATSPFFDRRSNNEQIRMQNIANGIQNLSGGMGAKQEEQELKRFTGLEFVLVHSREPTCFVVQKRWRTSPTETTPLAAYYVINDSIYQAPDLYSILATRLQSTVYALRMSLSTQRRARPSFDPRRGHHGRFIVADAPTSIDADSNRTCTTQSTHTHHADDHTPQLEHQQDHIHPPPPAAFTQPQLKKARFD |
Length | 254 |
Position | Head |
Organism | Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Ustilago.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.684 |
Instability index | 70.22 |
Isoelectric point | 7.86 |
Molecular weight | 28686.71 |
Publications | PubMed=17080091
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31772
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.22| 17| 229| 7| 25| 1
---------------------------------------------------------------------------
7- 25 (29.78/20.14) PPPeaPSNLLHVQFKNPEF
237- 253 (33.44/17.13) PPP..PAAFTQPQLKKARF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 144.42| 46| 130| 27| 75| 2
---------------------------------------------------------------------------
27- 75 (80.68/64.33) SYL.SHLQSTG...QVSLGRDSSC.AKFDPAHPlteHNVMAYFATSPF.FDRRSN
157- 208 (63.75/42.98) SILaTRLQSTVyalRMSLSTQRRArPSFDPRRG...HHGRFIVADAPTsIDADSN
---------------------------------------------------------------------------
|