<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31769
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSGEALDEIQWKSPEFIQERGLHTGNVLEYFSLSPFYDRTSNNQQLMMQFQFQQIQIPVNTTFQQFFQEKLREMTGVVFVIAYNREPDFWIIRKQLQLDPQNAVTLQDYYIIGANVYQAPKVYDVLSSRLLSSVLQLRNSIDLLNKMTQFHVSDGGHSYNNAIHQSTSNPTQGQSSGKSISATVGNTGTTATPMTMQTPQTVGPNGPATVQSGANSAAAISKNGSTSSAESADDRKNIYLDDIPLYGRGSTVEMLGLKVNLES |
| Length | 263 |
| Position | Head |
| Organism | Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Scheffersomyces.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.413 |
| Instability index | 37.13 |
| Isoelectric point | 5.36 |
| Molecular weight | 29148.21 |
| Publications | PubMed=17334359
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31769
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.39| 14| 17| 156| 171| 1
---------------------------------------------------------------------------
156- 169 (25.44/16.75) GHSYNNAIHQSTSN
173- 186 (22.95/ 7.93) GQSSGKSISATVGN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.73| 14| 17| 88| 101| 2
---------------------------------------------------------------------------
88- 101 (26.27/19.53) DFWIIRKQLQLDPQ
108- 121 (25.46/18.72) DYYIIGANVYQAPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.47| 16| 17| 205| 220| 3
---------------------------------------------------------------------------
205- 220 (25.80/19.12) NGPATVQSGANSAAAI
223- 238 (25.67/18.99) NGSTSSAESADDRKNI
---------------------------------------------------------------------------
|