<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31769

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMSGEALDEIQWKSPEFIQERGLHTGNVLEYFSLSPFYDRTSNNQQLMMQFQFQQIQIPVNTTFQQFFQEKLREMTGVVFVIAYNREPDFWIIRKQLQLDPQNAVTLQDYYIIGANVYQAPKVYDVLSSRLLSSVLQLRNSIDLLNKMTQFHVSDGGHSYNNAIHQSTSNPTQGQSSGKSISATVGNTGTTATPMTMQTPQTVGPNGPATVQSGANSAAAISKNGSTSSAESADDRKNIYLDDIPLYGRGSTVEMLGLKVNLES
Length263
PositionHead
OrganismScheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Scheffersomyces.
Aromaticity0.09
Grand average of hydropathy-0.413
Instability index37.13
Isoelectric point5.36
Molecular weight29148.21
Publications
PubMed=17334359

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31769
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.39|      14|      17|     156|     171|       1
---------------------------------------------------------------------------
  156-  169 (25.44/16.75)	GHSYNNAIHQSTSN
  173-  186 (22.95/ 7.93)	GQSSGKSISATVGN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.73|      14|      17|      88|     101|       2
---------------------------------------------------------------------------
   88-  101 (26.27/19.53)	DFWIIRKQLQLDPQ
  108-  121 (25.46/18.72)	DYYIIGANVYQAPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.47|      16|      17|     205|     220|       3
---------------------------------------------------------------------------
  205-  220 (25.80/19.12)	NGPATVQSGANSAAAI
  223-  238 (25.67/18.99)	NGSTSSAESADDRKNI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31769 with Med6 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SYNNAIHQSTSNPTQGQSSGKSISATVGNTGTTATPMTMQTPQTVGPNGPATVQSGANSAAAISKNGSTSSAESADDRKNIYLDDI
158
243










Molecular Recognition Features






MoRF SequenceStartStop




1) DDRKNIYLDDIPLYGR
233
248