<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31766
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSLPPLDELQWKSPEWIQTFGLHTDNVLDYFSESPFFDKTSNNQVVKMQQQFSQQSQVPGSMPLGSSSGIGAAAGAGTVSPSDRSLIWERYPVHAMLEKELMKMKGIEYILVLVREPDLWIIRKQQRDGPTKTTTLRDYYVIGSAVYQSPTVYKIIQNRLLSTNYHLSHSLSQLNKLVEFHPAQGASFLRPEDPLCSSVAAATTSGSTASHTVASSVSVPETGPINAETSGATAAATSIDPDRRQDSFNTEIMDKLMATSIKANPVYI |
Length | 268 |
Position | Head |
Organism | Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.302 |
Instability index | 52.49 |
Isoelectric point | 5.87 |
Molecular weight | 29471.92 |
Publications | PubMed=15229592
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP31766
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.66| 25| 158| 58| 84| 1
---------------------------------------------------------------------------
58- 84 (37.01/32.75) VPGSMPLGSSSGiGAAAGAGTVSPsDR
219- 243 (44.65/29.18) VPETGPINAETS.GATAAATSIDP.DR
---------------------------------------------------------------------------
|