Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSKEPLDEIQWKNPEWIQQFGLFTGNVLDYFSESPFYDRTSNNQVLRMQFQFQQIPPNINPQKYLQSKLVEMTGIEFIIAASREPDFWIIRKQTRLSPKQVNIEQDYYIIGANIYQAPKVYDILSSRLLSSVLSIKGSMELLNKMSKFNIHDMGHSYPTLQAEKEISSSSNTIPNTVSVNTTTPMLHTPATASNINSNGHSSTNLGLNNEISNLAFDNLLNNVINSSNDDTYLEDIPLYGKGSTVESLGVKVNLDDV |
Length | 257 |
Position | Head |
Organism | Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Debaryomyces. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.405 |
Instability index | 52.26 |
Isoelectric point | 5.00 |
Molecular weight | 29034.29 |
Publications | PubMed=15229592 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP31761 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 128.40| 42| 42| 125| 166| 1 --------------------------------------------------------------------------- 116- 160 (66.00/39.12) QAPKVYdilSSRLLSSVLSIKGSMELLN.KMSKFNIHDMGHSYPTL 161- 205 (62.40/36.64) QAEKEI.ssSSNTIPNTVSVNTTTPMLHtPATASNINSNGHSSTNL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 95.77| 27| 42| 39| 65| 3 --------------------------------------------------------------------------- 39- 65 (47.98/29.98) RTSNNQVLRMQFQFQQIPPNINPQKYL 83- 109 (47.80/29.84) REPDFWIIRKQTRLSPKQVNIEQDYYI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWIIRK 2) YLEDIPLY | 87 232 | 92 239 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab