| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MESLDEIQWKSPEFIQERGLNTNNVLEYFSLSPFYDRTSNNQVLMMQFQYQQIQIPPGVSFHQYFQSRLSEMTGIEFVIAYTKEPDFWIIRKQKRQDPQNTVTLQDYYIIGANVYQAPRIYDVLSSRLLASVLSIKNSTDLLNDMTSYHISDGGHSYINSIHGSSSKPSQSSAVSKPSSTNTGTNATTTPITLTTPSGATVPSTVSNGISTSTEIASGVFDTLLNDVVMNDDHLYIDEIPLYGEGSTLERLGLKGNKDAGLSL |
| Length | 263 |
| Position | Head |
| Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.357 |
| Instability index | 37.93 |
| Isoelectric point | 4.87 |
| Molecular weight | 29218.20 |
| Publications | PubMed=15123810 PubMed=17419877 PubMed=24025428 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP31756
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.58| 14| 17| 86| 99| 2
---------------------------------------------------------------------------
86- 99 (27.37/21.12) DFWIIRKQKRQDPQ
106- 119 (26.21/19.94) DYYIIGANVYQAPR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DEIPLY 2) VLEYF | 237 25 | 242 29 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab