<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31750
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAGTPDASMEEILWRSPPHVQMMGGYLHSNNILFYFAESPFFDPTSNNASLAIQANYNEAFRHFVETREAFEGRLKTMQGLEFVVSYDPIQAAAQPDGRFAHEPSNIWVIRKQNRRKRTGLDDEVAVLSTYFIVGDCIYMAPSVASVVGNRILSAVTSLTSLLKTASTLPTFTPSHGHTYMPPALKQADASQPGTQSQQSKENTPLPDADAAGKASLVGSSQMVGAGSSLQDTRTLAESFNLLRRYGDEFMDEHPLVGEPGSFILSRVNDTDRTSAAKPPATAAKVGTPQVRVDTPGKVSEKGATPSGSEENKMRKKKTKVGS |
| Length | 323 |
| Position | Head |
| Organism | Aspergillus niger (strain CBS 513.88 / FGSC A1513) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.434 |
| Instability index | 46.68 |
| Isoelectric point | 6.67 |
| Molecular weight | 35015.92 |
| Publications | PubMed=17259976
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31750
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 275.44| 79| 82| 133| 214| 1
---------------------------------------------------------------------------
75- 129 (39.18/13.97) ..............................LKTMQGLefvVSYDPIQ.........AAAQPDgrfAHEPSNiwviRKQNRRKRTGLDDEVAVLS
133- 214 (124.49/66.06) IVGDCiYMAPSVASVVGNRILSavTSLTSLLKTASTL...PTFTPSHGH..TYMPPALKQAD...ASQPGT....QSQQSKENTPLPDADAAGK
217- 298 (111.77/52.27) LVGSS.QMVGAGSSLQDTRTLA..ESFNLLRRYGDEF...MDEHPLVGEpgSFILSRVNDTDrtsAAKP......PATAAKVGTPQVRVDTPGK
---------------------------------------------------------------------------
|