<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31747
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDSSLLSAATADTFNGNAADQIPPPLQPPGTDMTGISFRDQLWINSYPLDRNYIFDYFALSPFYDTTCNNEILRRRSIHPLDLSHLSKMTGLEYMLTDATEPNLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCSVFAARVSRTIYNISKAFTDAASKLETIRQDLQVCLVAIVLSLSVNLGSYFLLIFKLMANGEQVYGFNKFLFDTENQNEPAESKPASETVDLKEMKRVDVILTSLYRKLAPPPPPPPFPEGYVSQEALGEKEELGTQGGESQPPQVDPIIDQGPAKRMKF |
| Length | 298 |
| Position | Head |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.292 |
| Instability index | 51.60 |
| Isoelectric point | 4.96 |
| Molecular weight | 33410.69 |
| Publications | PubMed=10907853
PubMed=27862469
PubMed=14593172
PubMed=17560376
PubMed=22021418
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. The Mediator complex, having a compact
conformation in its free form, is recruited to promoters by direct
interactions with regulatory proteins and serves for the assembly of a
functional preinitiation complex with RNA polymerase II and the general
transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IDA:UniProtKB
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31747
No repeats found
|