<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31746
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MNPGRLGLAPLLQENPLWISWHDSNWIPVLNPGNVMDYFSEKSNPFYDRTCNNEIVRMQRQSLELLNNMTGVEYIPLHVQDPILYVIRKQHRHSPTEATPMADYYIIAGTVYQAPDLASVFNSRILSTVHHLQTAFDEASSYSRYHPSKGYSWDFSSNKAIAEKTKTQTKKEAPVKEEPSSIFQRQRVDMLLGDLLRKFPLPLPQMTNNPTGGNPSDTANASNNHGGAAGDSDHVGADATLIKQEPTEGGVGRAGNNDVPPEKKMKL |
| Length | 267 |
| Position | Head |
| Organism | Anopheles gambiae (African malaria mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.639 |
| Instability index | 43.83 |
| Isoelectric point | 6.30 |
| Molecular weight | 29800.10 |
| Publications | PubMed=12364791
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31746
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 197.53| 61| 65| 115| 179| 1
---------------------------------------------------------------------------
119- 179 (104.28/62.24) SVFN.SRILSTVHHLQTAFDEASSYSRYHPSKGYSWDF...SSNKAIAEKTKTQTKKEAP.VKEEP
181- 246 (93.24/47.39) SIFQrQRVDMLLGDLLRKFPLPLPQMTNNPTGGNPSDTanaSNNHGGAAGDSDHVGADATlIKQEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.58| 12| 65| 10| 39| 2
---------------------------------------------------------------------------
1- 18 (19.07/27.52) MNPGRLglapllQENPLW
30- 47 (17.52/ 7.30) LNPGNVmdyfseKSNPFY
---------------------------------------------------------------------------
|