Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MNPGRLGLAPLLQENPLWISWHDSNWIPVLNPGNVMDYFSEKSNPFYDRTCNNEIVRMQRQSLELLNNMTGVEYIPLHVQDPILYVIRKQHRHSPTEATPMADYYIIAGTVYQAPDLASVFNSRILSTVHHLQTAFDEASSYSRYHPSKGYSWDFSSNKAIAEKTKTQTKKEAPVKEEPSSIFQRQRVDMLLGDLLRKFPLPLPQMTNNPTGGNPSDTANASNNHGGAAGDSDHVGADATLIKQEPTEGGVGRAGNNDVPPEKKMKL |
Length | 267 |
Position | Head |
Organism | Anopheles gambiae (African malaria mosquito) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.639 |
Instability index | 43.83 |
Isoelectric point | 6.30 |
Molecular weight | 29800.10 |
Publications | PubMed=12364791 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31746 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 197.53| 61| 65| 115| 179| 1 --------------------------------------------------------------------------- 119- 179 (104.28/62.24) SVFN.SRILSTVHHLQTAFDEASSYSRYHPSKGYSWDF...SSNKAIAEKTKTQTKKEAP.VKEEP 181- 246 (93.24/47.39) SIFQrQRVDMLLGDLLRKFPLPLPQMTNNPTGGNPSDTanaSNNHGGAAGDSDHVGADATlIKQEP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 36.58| 12| 65| 10| 39| 2 --------------------------------------------------------------------------- 1- 18 (19.07/27.52) MNPGRLglapllQENPLW 30- 47 (17.52/ 7.30) LNPGNVmdyfseKSNPFY --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKKMKL 2) VGADATLIKQEPTEGGV | 262 235 | 267 251 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab