<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31728
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MNSTPANSTPLPPLQPFTPGSSAATPAPIALTRSKPRRRLSSNVVGVSDRRRLLQMLQNVEEVSPGPDSASEAGESPSIRSQDEAHLEHLSSARICMDEDKELLIHQALPAFENTLLRFVQALSKYDFRQDLAETLMETESQFCEAVDELVEHQQAAQTIAALERVSEGLDDKIRDMIRKLAECRRELRNYQPNNENQSTLSSADLLTYATRIANFTTAPPYFRERPEHSKLPWPIEDEMRKGLLALMEVGKDKTELGELADPEKFAHTAANGVAPNGAAPVANGVAQNHNNGYAMERRLSTGYGSDNDGDTNMNGRSGLAGLDIFDDDDDDDDDD |
| Length | 336 |
| Position | Middle |
| Organism | Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Dipodascaceae> Yarrowia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.687 |
| Instability index | 50.52 |
| Isoelectric point | 4.66 |
| Molecular weight | 37034.48 |
| Publications | PubMed=11861549
PubMed=15229592
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31728
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.69| 17| 44| 11| 27| 1
---------------------------------------------------------------------------
11- 27 (31.09/18.49) LPPLQPFTPGSSAATPA
57- 73 (28.60/16.45) LQNVEEVSPGPDSASEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 130.49| 42| 46| 94| 138| 2
---------------------------------------------------------------------------
94- 138 (61.72/63.29) RICMDEDkELLIHQALPAFENTLLRFVQALSkyDFRQDLAETLME
142- 183 (68.77/55.96) QFCEAVD.ELVEHQQAAQTIAALERVSEGLD..DKIRDMIRKLAE
---------------------------------------------------------------------------
|