<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31725

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMAASSSGEKEKERMGGVSGMTGLGSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQLEEENQVLELLIHRDGDFQELMKLALNQGKVHHEMQALEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTSGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSVNMLPPNHSTDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD
Length270
PositionMiddle
OrganismRattus norvegicus (Rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Rattus.
Aromaticity0.03
Grand average of hydropathy-0.615
Instability index49.73
Isoelectric point4.96
Molecular weight29825.20
Publications
PubMed=15489334

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	ISO:RGD
nucleoplasm	GO:0005654	IEA:Ensembl
nucleus	GO:0005634	ISO:RGD
GO - Biological Function
thyroid hormone receptor binding	GO:0046966	ISO:RGD
transcription coactivator activity	GO:0003713	ISO:RGD
transcription coregulator activity	GO:0003712	ISO:RGD
GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	ISO:RGD
positive regulation of transcription, DNA-templated	GO:0045893	ISO:RGD
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central
transcription by RNA polymerase II	GO:0006366	ISO:RGD

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31725
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.87|      24|      24|     214|     237|       1
---------------------------------------------------------------------------
  214-  237 (45.93/28.36)	D.VLAPQYPWQSNDMSVNMLPPNHS
  239-  263 (36.94/21.58)	DfLLEPPGHNKENEDDVEVMSTDSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.76|      11|      24|      25|      36|       2
---------------------------------------------------------------------------
   25-   36 (13.51/11.88)	STRERLLSaLED
   51-   61 (18.25/10.80)	SRNQKLLQ.LEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.80|      20|      28|      62|      88|       3
---------------------------------------------------------------------------
   62-   81 (35.78/33.26)	ENQVLELLI.HRDGDFQELMK
   92-  112 (30.02/12.84)	EMQALEKEVeKRDSDIQQLQK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31725 with Med4 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TWVPGDPRRPYPTDLEMRSGLLGQMNNPSTSGVNGHLPGDALAAG
2) WQSNDMSVNMLPPNHSTDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD
166
222
210
270










Molecular Recognition Features






MoRF SequenceStartStop




NANANA