Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MEDVLSTHFDRIEKALSTLVDSIAAYNPSPQAAIDLVAADDQLSHGLDQLSRHQANHARILTLRAQVEALEEQKKSSVTALATLRHELHATPATSFPADTRPVRFDELLQYAKNISQYTVPPTYRERAPEAASDKDRDKDDAASSGVNTPAHAPAQPDSDAPKDRDNADNKPAEVTAEEEEWLEKLQKSQIAWYPWPSEEKIRIGNLSKLMYWQARGKDVDDFDIPAHEEAQRKGLAGVVEAPPEPEPVAEPVQAQAPRPARPAQPQATFDMFDDLDD |
Length | 278 |
Position | Middle |
Organism | Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Phaeosphaeriaceae> Parastagonospora. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.776 |
Instability index | 52.22 |
Isoelectric point | 4.72 |
Molecular weight | 30839.62 |
Publications | PubMed=18024570 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31723 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.33| 18| 108| 150| 167| 1 --------------------------------------------------------------------------- 122- 139 (30.78/14.11) PTYRERAPEAASDKDRDK 150- 167 (33.55/16.00) PAHAPAQPDSDAPKDRDN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QATFDMFDDLDD 2) VAEPVQAQAP | 267 249 | 278 258 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab