<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31722
| Description |
Isoform 2 of Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAASSSGEKEKERMGGVSGMAGLGSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQLEEENQVLELLIHRDGDFQELMKLALNQGKVHHEMQALEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTSGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSVNMLPPNHSSDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 177 |
| Position | Middle |
| Organism | Mus musculus (Mouse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.606 |
| Instability index | 51.32 |
| Isoelectric point | 4.96 |
| Molecular weight | 29781.15 |
| Publications | PubMed=16141072
PubMed=15489334
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IDA:MGI
nucleoplasm GO:0005654 ISO:MGI
nucleus GO:0005634 ISO:MGI
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 ISO:MGI
transcription coactivator activity GO:0003713 ISO:MGI
transcription coregulator activity GO:0003712 ISO:MGI
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 ISO:MGI
positive regulation of transcription, DNA-templated GO:0045893 ISO:MGI
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
transcription by RNA polymerase II GO:0006366 ISO:MGI
|
Interaction
Repeat regions
| Repeats |
>MDP31722
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.87| 24| 24| 214| 237| 1
---------------------------------------------------------------------------
214- 237 (45.93/28.49) D.VLAPQYPWQSNDMSVNMLPPNHS
239- 263 (36.94/21.67) DfLLEPPGHNKENEDDVEVMSTDSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.76| 11| 24| 25| 36| 2
---------------------------------------------------------------------------
25- 36 (13.51/13.28) STRERLLSaLED
51- 61 (18.25/12.07) SRNQKLLQ.LEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.80| 20| 28| 62| 88| 3
---------------------------------------------------------------------------
62- 81 (35.78/32.56) ENQVLELLI.HRDGDFQELMK
92- 112 (30.02/12.57) EMQALEKEVeKRDSDIQQLQK
---------------------------------------------------------------------------
|