<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31718
| Description |
Putative mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MNKRINEVSGRPIGEYLSRDISDFQRVSRTLFECFSSLATGATLNSQQLQQIQLPIDQISNNATPNMVLQLMNHLIDVDKIYQNTLKKLEKHQKIQKEITEIQKEIEEKDKLISTLALNLKDIESFLENELSQDNVNINNGNASDGIVNEVLIDLKQPDDAASMDNIVNREVSPEDLISYAHKISGTTSAPFGYQPNAPLASLFKPPAPQDEMMRSSVLFTKPPPHVLKYYGLAEIDVTTPTMAANISSPFSIGGNVGDVTTPTSKEQEDQQQQQQQQQPQQQLSQSQQSQQQTESELQPIQSILQPPQQLNIDLDLNPDLDSSGDDDDEDDDDEESEEVEWD |
| Length | 343 |
| Position | Middle |
| Organism | Dictyostelium discoideum (Slime mold) |
| Kingdom | Amoebozoa |
| Lineage | Eukaryota> Amoebozoa> Evosea> Eumycetozoa> Dictyostelia> Dictyosteliales>
Dictyosteliaceae> Dictyostelium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.739 |
| Instability index | 66.30 |
| Isoelectric point | 4.22 |
| Molecular weight | 38448.94 |
| Publications | PubMed=15875012
PubMed=18515835
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 ISS:dictyBase
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31718
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.71| 18| 19| 265| 282| 1
---------------------------------------------------------------------------
265- 282 (33.20/12.62) SKEQEDQQQQQQQQQPQQ
285- 302 (31.51/11.68) SQSQQSQQQTESELQPIQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.96| 14| 19| 145| 163| 2
---------------------------------------------------------------------------
145- 163 (20.46/25.36) DGIVN.EVlidlkQPDDAAS
165- 179 (21.50/12.87) DNIVNrEV.....SPEDLIS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.95| 16| 196| 116| 135| 6
---------------------------------------------------------------------------
104- 119 (24.15/17.13) KEIE...EKDKLISTLALN
121- 139 (20.80/18.48) KDIEsflENELSQDNVNIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.62| 18| 19| 42| 59| 7
---------------------------------------------------------------------------
42- 59 (30.79/21.18) ATLN.SQQLQQIQLPIDQI
63- 81 (26.82/17.46) ATPNmVLQLMNHLIDVDKI
---------------------------------------------------------------------------
|