<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31717
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MIPHKKNDSSFLSVPVSRVGSTQRLNQLASHGVATGSPNAYSSIPSTPSAYVSSSLNPTKGISAGPESSNQIITKEDRDAFGKLSIVEKVNEFEQNLTNLSFKVSSFKEDELASLIGKLIELNDIICSEIGELKKHRDLGILIKGLKDDQAHLDNTSKIILKELITYRNELKKLPRLPSNKNKASVFPSPNDSKVDVNEVLKYASKLSKFTKAPPTVSNLPFQIHPNNYVWPAEDALRRGMLAMSSIKVDDIINAELGEDTLEVKEEAIKKVEDNKVESITNSPPAERRGSFGERTGESRKQESQGALDLDLFDPDEEDFSD |
Length | 322 |
Position | Middle |
Organism | Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Debaryomyces.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.561 |
Instability index | 39.29 |
Isoelectric point | 5.48 |
Molecular weight | 35509.50 |
Publications | PubMed=15229592
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP31717
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.71| 22| 37| 155| 191| 1
---------------------------------------------------------------------------
157- 178 (36.23/38.28) SKIILKELITYRNELKKLPRLP
193- 214 (35.48/ 8.65) SKVDVNEVLKYASKLSKFTKAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.05| 24| 124| 99| 132| 2
---------------------------------------------------------------------------
109- 132 (40.04/29.90) EDEL..ASLIGKLIELNDIICSEIGE
234- 259 (35.01/13.59) EDALrrGMLAMSSIKVDDIINAELGE
---------------------------------------------------------------------------
|