<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31716
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAAAAADKSTKERLLSTLDDLEVLSRELIEMLALSRSQKLPPPGEDTLILELLIQRDKEFQELMQTALEQGRVHQEMQSLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGSISSKEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGNMSNMSTNGVNGHLPGDALAAGRLPDVLTPQYPWQSTDVSMGILPPHHGNDFGLEPPGHNKENEDDVEAMSTDSSSSSSDSD |
| Length | 254 |
| Position | Middle |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.646 |
| Instability index | 50.80 |
| Isoelectric point | 5.02 |
| Molecular weight | 28052.22 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31716
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.00| 15| 32| 55| 70| 1
---------------------------------------------------------------------------
55- 70 (20.93/18.34) QRDKEFQELmQTALEQ
86- 100 (25.06/16.10) KRDSDIQQL.QKQLKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.30| 14| 32| 142| 155| 2
---------------------------------------------------------------------------
142- 155 (28.58/19.51) SNAVCAPLN.WVPGD
175- 189 (22.72/14.26) SNMSTNGVNgHLPGD
---------------------------------------------------------------------------
|