<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31715
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAHTTPRSHPPPHSLLQNLTTQSLLLSHLFTLIASPPNPNTSTQTQLNQVYSALQLSTLDLSGLVKEVGHHQEAYRRLVEKKNEVAGLEMRVRGLVKRLEEGRKELEGMIDQGERSLEDIEKSEREPVPAKTLMAHAQSLSKHSSAPVSSLLAPVDKAQYAPWPTEMSMRMGLLFQLEGSMSGMGERGVVGEEQKAPQKVEERREHVEHEESDRRYDPNAVFQLDLNSDESDED |
| Length | 234 |
| Position | Middle |
| Organism | Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus>
Cryptococcus neoformans species complex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.724 |
| Instability index | 53.86 |
| Isoelectric point | 5.42 |
| Molecular weight | 26249.17 |
| Publications | PubMed=15653466
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31715
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 118.30| 39| 77| 88| 128| 1
---------------------------------------------------------------------------
88- 128 (55.35/39.05) LEMRVrGLVKRLEEGRKELE..GMIDQGERSLEDIEKSeREPV
167- 207 (62.95/35.90) MSMRM.GLLFQLEGSMSGMGerGVVGEEQKAPQKVEER.REHV
---------------------------------------------------------------------------
|