<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31712
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLPFKKADSPFKSNPVSRVGSSTRLNQLGNIKSNPTTPNAALYVTSSLNPSKNLPTNAANVKSRLQTQKDLDAFKQLPMVQKVNEYERLLNELSEAVSQFKNDELQEKIGQIITCNDVLKQQIEDLNKHRNYSYEVDKLSDRNKILEENSKFILKELVSYRNELKKLPKLPKSDKMVNRNVDVDDILKYAFKLAKFTKAPATVANMPFQIHPNNYVWPAEDSLRRGMLAQASLQAEEIIRHELGETDKENSNEVKTESKVDHDDDDDDEMEDVRISNENTNDEQRSKPPAASEHDTSKRKEEQNQQPVDLNLDLFDPDDEYSD |
| Length | 323 |
| Position | Middle |
| Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.991 |
| Instability index | 41.93 |
| Isoelectric point | 5.11 |
| Molecular weight | 37007.75 |
| Publications | PubMed=15123810
PubMed=17419877
PubMed=24025428
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31712
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.19| 16| 17| 32| 48| 1
---------------------------------------------------------------------------
12- 25 (22.60/12.06) KSNPVSRVGS...STRL
32- 48 (24.98/18.77) KSNPTTPNAAlYVTSSL
52- 65 (24.61/13.68) KNLPT..NAA.NVKSRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.87| 25| 25| 148| 172| 2
---------------------------------------------------------------------------
121- 151 (29.10/21.32) QQIEDLNKHRNYSYEVDKLSDrnkileENSK
152- 182 (31.25/23.53) FILKELVSYRNELKKLPKLPKsdkmvnRNVD
183- 207 (21.52/13.50) ..VDDILKYAFKLAKFTKAPA....tvANMP
---------------------------------------------------------------------------
|