Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MTESDERSLRDLLLESADDLENVLKMIIDTLINREKSVMLKSGESVTNIVRLFDAKQESVRKLLQKVPEFQERESLIRTLKAHVEKRDEVIQQVENNLKACEVALTRSCFHANQKVKKMNEAALRPVNSETLIKLSHQISKHNSVSAPLTWQIGDPSRPFPQEHEFRTGQLLNPKIQSSGPQILLGKSSAQKPIIASPSASSSNGGTAPTRTVGTPLVNSATNGDYSPRTGYGAEETSPIQEQVLLGVTPNEKQWQNPPMPGAATSSQSPLSGAPQSPSSPSVKLKISGIPNRPGDIDQVQEVRDVEQMSSDSSNSSDSSDDEGSSKKTRGRNK |
Length | 334 |
Position | Middle |
Organism | Caenorhabditis briggsae |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.706 |
Instability index | 56.30 |
Isoelectric point | 6.99 |
Molecular weight | 36469.41 |
Publications | PubMed=14624247 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31710 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 120.00| 35| 39| 216| 251| 3 --------------------------------------------------------------------------- 216- 251 (57.30/31.45) PLVNSATNGDYSPRTGYGAEETSPIQEQVLLGVtPN 258- 292 (62.70/31.04) PPMPGAATSSQSPLSGAPQSPSSPSVKLKISGI.PN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SSKKTRGRNK 2) VKLKISGIPNRPGDIDQVQEVRDV | 325 283 | 334 306 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab