<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31709
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAAASSGEKEKERPGGGLGAAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQSGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMAMNMLPPNHSHDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 270 |
| Position | Middle |
| Organism | Bos taurus (Bovine) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Bovinae> Bos.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.650 |
| Instability index | 48.47 |
| Isoelectric point | 5.07 |
| Molecular weight | 29707.01 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
transcription by RNA polymerase II GO:0006366 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP31709
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.67| 27| 28| 62| 88| 1
---------------------------------------------------------------------------
37- 56 (24.35/14.00) ....LEVL..SR..ELIEMLAISRNQKL
62- 88 (46.71/32.72) ENQVLELLI.HRDGEFQELMKLALNQGK
92- 112 (21.61/11.70) EMQVLEKEVeKRDSDIQQLQK.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.34| 22| 23| 205| 226| 2
---------------------------------------------------------------------------
205- 226 (39.35/21.30) DALAAGRLPD.VLAPQYPWQSND
230- 252 (36.99/19.66) NMLPPNHSHDfLLEPPGHNKENE
---------------------------------------------------------------------------
|