| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSANQLSKAATPKATPLGAAQGASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTGIRKPPPASDADSSVVDDGDASMDLDLNLFNPDEF |
| Length | 294 |
| Position | Middle |
| Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Eremothecium. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.526 |
| Instability index | 41.52 |
| Isoelectric point | 4.64 |
| Molecular weight | 32150.53 |
| Publications | PubMed=15001715 PubMed=23749448 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats |
>MDP31708
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 111.02| 34| 77| 134| 167| 1
---------------------------------------------------------------------------
134- 167 (57.74/33.15) DLNSLPMVEQVEFEMATMKKQKDKVNSSV.LLEYA
212- 246 (53.28/30.11) ELTSLPGQSDQEAEQASAGKEADTAGPGVsTLEPA
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) HNRRGSFEFTGIRKPPP 2) MDLDLNLFNPDEF | 250 282 | 266 294 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab