Description | Mediator of RNA polymerase II transcription subunit 3 |
Sequence | MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARIKKAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSNDFEELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAPTPGAGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQAAAAAAAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIPANAMNNMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSPMAGQGQLNQMFPMQNHNQNGQFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMNPSMNMNMGMNLNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQSQNQSQNQNQSMNMNMNNDSNNPKSAYDLVDFNSLDLSSLNMDFL |
Length | 481 |
Position | Tail |
Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Nakaseomyces> Nakaseomyces/Candida clade. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.874 |
Instability index | 38.74 |
Isoelectric point | 8.84 |
Molecular weight | 52083.78 |
Publications | PubMed=15229592 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31702 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 87.97| 20| 22| 293| 313| 1 --------------------------------------------------------------------------- 251- 269 (29.69/ 8.12) NP.........gmNSNMGTPVMGNPNMK 285- 311 (30.56/12.78) VPhngamrPSV.pNGNMGNPSMGNLNMN 391- 406 (27.73/ 6.95) MN......PSM..NMNMG...M.NLNQI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 91.13| 21| 22| 155| 176| 2 --------------------------------------------------------------------------- 155- 175 (39.30/24.10) TP.TTAPTPGAGTKKAAKTAPT 178- 191 (23.90/ 6.72) AT.ATIGTPS...NN....APT 192- 212 (27.93/ 9.79) .PaTTATTPGTQAKKPRKPRQT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 107.71| 21| 21| 347| 367| 3 --------------------------------------------------------------------------- 315- 339 (31.63/ 9.03) MGNPNMNNPNMnnpnAMMSPMA...GQG 347- 367 (44.50/16.44) MQNHNQNGQFM....GQQSPGP...NIG 369- 390 (31.58/ 9.01) MQFPPNNGNMN....GM..PGTsdmNLG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 89.26| 32| 40| 45| 83| 4 --------------------------------------------------------------------------- 45- 83 (44.18/45.63) KKAEDgilplRLQ..FNDFTQI...MSSLDEerYANVSKQEKFQ 90- 126 (45.08/28.00) LGLTE.....RLQelSNDFEELqplFATVGE..YSKTYKNKNFQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 91.55| 16| 17| 424| 439| 5 --------------------------------------------------------------------------- 231- 246 (29.11/10.79) QAQAQAQNQNQNNMQN 424- 439 (33.18/13.39) QNIGMDQNQNQNQSQN 444- 458 (29.26/10.88) QNQSMNMNMN.NDSNN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKAAKTA 2) LNMDFL 3) YDLVDF | 167 476 463 | 173 481 468 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab