<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31702
| Description |
Mediator of RNA polymerase II transcription subunit 3 |
| Sequence | MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARIKKAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSNDFEELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAPTPGAGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQAAAAAAAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIPANAMNNMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSPMAGQGQLNQMFPMQNHNQNGQFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMNPSMNMNMGMNLNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQSQNQSQNQNQSMNMNMNNDSNNPKSAYDLVDFNSLDLSSLNMDFL |
| Length | 481 |
| Position | Tail |
| Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Nakaseomyces>
Nakaseomyces/Candida clade.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.874 |
| Instability index | 38.74 |
| Isoelectric point | 8.84 |
| Molecular weight | 52083.78 |
| Publications | PubMed=15229592
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31702
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.97| 20| 22| 293| 313| 1
---------------------------------------------------------------------------
251- 269 (29.69/ 8.12) NP.........gmNSNMGTPVMGNPNMK
285- 311 (30.56/12.78) VPhngamrPSV.pNGNMGNPSMGNLNMN
391- 406 (27.73/ 6.95) MN......PSM..NMNMG...M.NLNQI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.13| 21| 22| 155| 176| 2
---------------------------------------------------------------------------
155- 175 (39.30/24.10) TP.TTAPTPGAGTKKAAKTAPT
178- 191 (23.90/ 6.72) AT.ATIGTPS...NN....APT
192- 212 (27.93/ 9.79) .PaTTATTPGTQAKKPRKPRQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 107.71| 21| 21| 347| 367| 3
---------------------------------------------------------------------------
315- 339 (31.63/ 9.03) MGNPNMNNPNMnnpnAMMSPMA...GQG
347- 367 (44.50/16.44) MQNHNQNGQFM....GQQSPGP...NIG
369- 390 (31.58/ 9.01) MQFPPNNGNMN....GM..PGTsdmNLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.26| 32| 40| 45| 83| 4
---------------------------------------------------------------------------
45- 83 (44.18/45.63) KKAEDgilplRLQ..FNDFTQI...MSSLDEerYANVSKQEKFQ
90- 126 (45.08/28.00) LGLTE.....RLQelSNDFEELqplFATVGE..YSKTYKNKNFQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.55| 16| 17| 424| 439| 5
---------------------------------------------------------------------------
231- 246 (29.11/10.79) QAQAQAQNQNQNNMQN
424- 439 (33.18/13.39) QNIGMDQNQNQNQSQN
444- 458 (29.26/10.88) QNQSMNMNMN.NDSNN
---------------------------------------------------------------------------
|