<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31701
| Description |
Mediator of RNA polymerase II transcription subunit 3 |
| Sequence | MGSNIDGILRENLTLEELQEWLTSSEGNKLAIDDHIKATQGRVLPLRLLFNEFLRTISHIEQLSDKTPQEKFQLIRSKLQELYGKLHALVRDFQRLQPLFDTMVPFSETSERKFYPKETLGTAVEPVRPLASPSYRRPSNRSSADTPSSNAPTPSAAVVSGAALVAPQVKHQRRPRTNTAKRQPSVSASVVPSANSSGPATIPGATPLMLSGMSPLNMVASPLNGISPSRKPAQPHHQTTPSAALGMQPMQQKQMSIQAKATPSKSGTISSANLTPQSILNMSAFENSAGGVPNSAVPLNQNNNAIMGFPTDIDNIDLNALELGSLNMDLLG |
| Length | 332 |
| Position | Tail |
| Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.382 |
| Instability index | 63.16 |
| Isoelectric point | 9.48 |
| Molecular weight | 35771.23 |
| Publications | PubMed=15001715
PubMed=23749448
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31701
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 144.38| 34| 34| 130| 163| 1
---------------------------------------------------------------------------
124- 157 (60.74/30.10) VEPVRP..................LASPS...YR.RPSNRSSADTPS.SNAPTPSAA
158- 195 (44.97/20.50) VVSGAA..................LVAPQvkhQR.RPRTNTAKRQPSvSASVVPSAN
196- 244 (38.67/16.66) S.SGPAtipgatplmlsgmsplnmVASPL...NGiSPS.RKPAQ.P..HHQTTPSAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 125.10| 40| 43| 30| 72| 2
---------------------------------------------------------------------------
9- 42 (31.97/18.49) ........LRENLTLEEL...QEwLTSSEgNKLAIDDHIKATQGR
46- 85 (64.60/51.16) LRLLFNEFLRTISHIEQL...SD.KTPQE.KFQLIRSKLQELYGK
86- 114 (28.53/12.33) LHALVRDFQRLQPLFDTMvpfSE..TSER.KF.............
---------------------------------------------------------------------------
|