<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31694

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMETKWLLSKVPDDKSRFEIELEFVQMLSNPWYLNFLAQHKYFEDEAFLQYLEYMEYWREPEYVKFIIYPTCLHMLTLLKNPQFRNDISRADLSKQVNDEIYYEWLGKGLQQYGSADDATLSQPQQEEDEKKVDVKKENE
Length139
PositionMiddle
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae> Schizosaccharomyces.
Aromaticity0.15
Grand average of hydropathy-0.794
Instability index40.77
Isoelectric point4.65
Molecular weight16895.83
Publications
PubMed=12471453
PubMed=11859360

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
cytosol	GO:0005829	HDA:PomBase
mediator complex	GO:0016592	IDA:PomBase
nucleus	GO:0005634	HDA:PomBase
P:positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IPomBase
GO - Biological Function
transcription coactivator activity	GO:0003713	TAS:PomBase
GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IC:PomBase
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31694
No repeats found
No repeats found




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31694 with Med31 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) RADLSKQVNDEIYYEWLGKGLQQYGSADDATLSQPQQEEDEKKVDVKKENE
89
139