<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31685
| Description |
Isoform 2 of Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAKMYGKGKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQANGMEAATGGESAAPTPNVNGSASTADSQQTSSALQPVQAQPGNPQQQQQINGVASGANIKLELN |
| Length | 133 |
| Position | Middle |
| Organism | Drosophila melanogaster (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.702 |
| Instability index | 67.40 |
| Isoelectric point | 7.61 |
| Molecular weight | 23530.24 |
| Publications | PubMed=10731132
PubMed=12537572
PubMed=12537569
PubMed=11259581
PubMed=16751183
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Required for activated
transcription of the MtnA gene.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IDA:UniProtKB
nucleus GO:0005634 IDA:FlyBase
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | anterior/posterior axis specification, embryo GO:0008595 IMFlyBase
positive regulation of transcription, DNA-templated GO:0045893 IEA:GOC
regulation of transcription by RNA polymerase II GO:0006357 IDA:UniProtKB
|
Interaction
Repeat regions
| Repeats |
>MDP31685
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.46| 15| 18| 67| 81| 2
---------------------------------------------------------------------------
67- 81 (30.05/23.72) YAKY...LMYPMCLYFLD
85- 102 (24.41/17.96) YEHFrreIVNSQCCKFID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.57| 10| 29| 157| 166| 4
---------------------------------------------------------------------------
157- 166 (17.63/10.40) NVNGSASTAD
189- 198 (17.94/10.66) QINGVASGAN
---------------------------------------------------------------------------
|