<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31681
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAQEAGLIPPPPHLSNPRFTLELEFVLSLANPYYISHLAVTYPHLLGISSQSTDNDDPSASSDAKAFAAYLAYLYDYWKRPEYVQFLTHPGATLRALRLLQEESFRKAVIRPQVIEALLGTTTEVDLHVESEEDREKNNEEQAEKGSNGATS |
Length | 152 |
Position | Middle |
Organism | Coccidioides immitis (strain RS) (Valley fever fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.429 |
Instability index | 48.17 |
Isoelectric point | 4.84 |
Molecular weight | 16991.71 |
Publications | PubMed=19717792
PubMed=20516208
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP31681
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.17| 26| 30| 80| 107| 1
---------------------------------------------------------------------------
80- 107 (38.87/32.82) RPEYVQFLThpGATLRA.LRLLQEESFRK
111- 137 (38.30/24.47) RPQVIEALL..GTTTEVdLHVESEEDREK
---------------------------------------------------------------------------
|