Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSAQTDQPITEQQKKEQEQYTNLINSLPTRWEIELEFVQSLSNIPYVNYLAQNNYFNDENFINYLNYLQYWTQPEYSKFLVYPNCLHILKLLQDENFRKNIINQDFMNSLMNDMVKRWQSNANDQDENKEKEENKEVPEVRINGTN |
Length | 146 |
Position | Middle |
Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
Aromaticity | 0.12 |
Grand average of hydropathy | -1.001 |
Instability index | 62.45 |
Isoelectric point | 4.58 |
Molecular weight | 17671.39 |
Publications | PubMed=15123810 PubMed=17419877 PubMed=24025428 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | filamentous growth of a population of unicellular organisms GO:0044182 IMCGD growth of unicellular organism as a thread of attached cells GO:0070783 IMCGD positive regulation of single-species biofilm formation on inanimate substrate GO:1900233 IMCGD regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central septum digestion after cytokinesis GO:0000920 IMCGD single-species biofilm formation on inanimate substrate GO:0044011 IMCGD |
Binary Interactions |
Repeats | >MDP31679 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 115.03| 35| 38| 24| 61| 1 --------------------------------------------------------------------------- 16- 41 (25.05/ 8.36) ............EQEQY..........tnlINSLPTRWEIELEFVQSL 45- 80 (57.43/31.19) PYVNYLAQNNYFNDENF..........inyLNYLQY.W.TQPEYSKFL 81- 119 (32.55/10.41) VYPNCLHILKLLQDENFrkniinqdfmnslMNDMVKRWQ......... --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DMVKRWQ 2) IPYVNYL 3) KEKEENKEVPEVRINGTN | 113 44 129 | 119 50 146 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab