<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31679
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSAQTDQPITEQQKKEQEQYTNLINSLPTRWEIELEFVQSLSNIPYVNYLAQNNYFNDENFINYLNYLQYWTQPEYSKFLVYPNCLHILKLLQDENFRKNIINQDFMNSLMNDMVKRWQSNANDQDENKEKEENKEVPEVRINGTN |
| Length | 146 |
| Position | Middle |
| Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -1.001 |
| Instability index | 62.45 |
| Isoelectric point | 4.58 |
| Molecular weight | 17671.39 |
| Publications | PubMed=15123810
PubMed=17419877
PubMed=24025428
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | filamentous growth of a population of unicellular organisms GO:0044182 IMCGD
growth of unicellular organism as a thread of attached cells GO:0070783 IMCGD
positive regulation of single-species biofilm formation on inanimate substrate GO:1900233 IMCGD
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
septum digestion after cytokinesis GO:0000920 IMCGD
single-species biofilm formation on inanimate substrate GO:0044011 IMCGD
|
Interaction
Repeat regions
| Repeats |
>MDP31679
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 115.03| 35| 38| 24| 61| 1
---------------------------------------------------------------------------
16- 41 (25.05/ 8.36) ............EQEQY..........tnlINSLPTRWEIELEFVQSL
45- 80 (57.43/31.19) PYVNYLAQNNYFNDENF..........inyLNYLQY.W.TQPEYSKFL
81- 119 (32.55/10.41) VYPNCLHILKLLQDENFrkniinqdfmnslMNDMVKRWQ.........
---------------------------------------------------------------------------
|