<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31677
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | METPESEKTRFEVECEFVQALANPNYLNFLAQRGYFKEEYFVNYLKYLLYWKNPQYARCLKFPQCLHMLEALQSQQFRDAMAYGPSAKFVEDQVVLQWQFYLRKRHRLCMLPEGEDQDVEESEEETVENEQKESEDEEDVVIVEKPEDEQEEQAEEAAEPTDTSLLNT |
| Length | 168 |
| Position | Middle |
| Organism | Caenorhabditis briggsae |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.865 |
| Instability index | 65.48 |
| Isoelectric point | 4.31 |
| Molecular weight | 20030.94 |
| Publications | PubMed=14624247
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31677
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.74| 13| 29| 115| 128| 1
---------------------------------------------------------------------------
115- 128 (17.87/ 9.96) EDQDvEESEEETVE
147- 159 (21.87/ 8.73) EDEQ.EEQAEEAAE
---------------------------------------------------------------------------
|