| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDQQPPVQPQQRPPPSLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISKSSDDSNTSTEGPDPEAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEESFRRDIIRPQVIEALAGNGLENVQGGQNVEAGDTGHNEGDQGTQQDKENIALKT |
| Length | 162 |
| Position | Middle |
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.646 |
| Instability index | 46.62 |
| Isoelectric point | 4.67 |
| Molecular weight | 17934.55 |
| Publications | PubMed=16372009 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats | >MDP31673 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) IALKT 2) PEAQAFAAYLAYLYS | 158 67 | 162 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab