Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MDQQPPVQPQQRPPPSLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISKSSDDSNTSTEGPDPEAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEESFRRDIIRPQVIEALAGNGLENVQGGQNVEAGDTGHNEGDQGTQQDKENIALKT |
Length | 162 |
Position | Middle |
Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.646 |
Instability index | 46.62 |
Isoelectric point | 4.67 |
Molecular weight | 17934.55 |
Publications | PubMed=16372009 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31673 No repeats found |
MoRF Sequence | Start | Stop |
1) IALKT 2) PEAQAFAAYLAYLYS | 158 67 | 162 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab