<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31672
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDQQPGPVQQSSPPNLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISKSGDEGETSNESSDPEAKAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEETFRRDIIRPQVIEALAGTGVDEQGAQDTQEGEGEQKQNKEEDAQDAQENTESKT |
| Length | 161 |
| Position | Middle |
| Organism | Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Fumigati.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.804 |
| Instability index | 53.19 |
| Isoelectric point | 4.40 |
| Molecular weight | 17916.31 |
| Publications | PubMed=18404212
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31672
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 133.05| 43| 79| 20| 67| 1
---------------------------------------------------------------------------
20- 67 (66.46/48.15) RFTLELEFVSSLANPYYLSHLAVTypnllGISKSG....DEGETSNESSDPE
102- 148 (66.59/37.67) RLLQEETFRRDIIRPQVIEALAGT.....GVDEQGaqdtQEGEGEQKQNKEE
---------------------------------------------------------------------------
|