Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MDQQPGPVQQSSPPNLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISKSGDEGETSNESSDPEAKAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEETFRRDIIRPQVIEALAGTGVDEQGAQDTQEGEGEQKQNKEEDAQDAQENTESKT |
Length | 161 |
Position | Middle |
Organism | Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.804 |
Instability index | 53.19 |
Isoelectric point | 4.40 |
Molecular weight | 17916.31 |
Publications | PubMed=18404212 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31672 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 133.05| 43| 79| 20| 67| 1 --------------------------------------------------------------------------- 20- 67 (66.46/48.15) RFTLELEFVSSLANPYYLSHLAVTypnllGISKSG....DEGETSNESSDPE 102- 148 (66.59/37.67) RLLQEETFRRDIIRPQVIEALAGT.....GVDEQGaqdtQEGEGEQKQNKEE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EAKAFAAYLAYLYSYW 2) EQKQNKEEDAQDAQENT | 67 141 | 82 157 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab