<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31671
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSAKSSEPPFEPSSEGEQLPSRFEVELEFVQSLANIPYVTFLLTQHQIWQDPRFKAYLKYLEYWCEPPYTQFIVYPNCLFVLKLLNSFLDKAVENEDGILEGAEDLPKVIQMQGGEWMNQMVERWRG |
Length | 127 |
Position | Middle |
Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.355 |
Instability index | 45.10 |
Isoelectric point | 4.52 |
Molecular weight | 14913.83 |
Publications | PubMed=15001715
PubMed=23749448
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | DNA repair GO:0006281 IEA:EnsemblFungi
meiotic gene conversion GO:0006311 IEA:EnsemblFungi
meiotic sister chromatid segregation GO:0045144 IEA:EnsemblFungi
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP31671
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.11| 24| 29| 18| 42| 1
---------------------------------------------------------------------------
18- 42 (37.52/29.59) QLPsRFEVELEFVQSLANIPYVTFL
50- 73 (48.59/33.79) QDP.RFKAYLKYLEYWCEPPYTQFI
---------------------------------------------------------------------------
|