Description | Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MSTPPLAPTGMASGPFGGPQAQQAAREVNTATLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVDEDGSKNDDRAGPPRFASEERREIVEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 178 |
Position | Head |
Organism | Mus musculus (Mouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Mus> Mus. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.617 |
Instability index | 42.29 |
Isoelectric point | 8.45 |
Molecular weight | 20358.14 |
Publications | PubMed=16141072 PubMed=15489334 PubMed=21183079 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IDA:MGI nucleoplasm GO:0005654 TAS:Reactome nucleus GO:0005634 ISO:MGI ubiquitin ligase complex GO:0000151 ISO:MGI |
GO - Biological Function | thyroid hormone receptor binding GO:0046966 ISO:MGI transcription coactivator activity GO:0003713 ISO:MGI transcription coregulator activity GO:0003712 ISO:MGI ubiquitin protein ligase activity GO:0061630 IEA:Ensembl |
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 ISO:MGI positive regulation of transcription, DNA-templated GO:0045893 ISO:MGI protein ubiquitination GO:0016567 ISO:MGI stem cell population maintenance GO:0019827 IMMGI |
Binary Interactions | [Q9CQI9<-->Q9R0X0: Med20] NbExp=2 EBI-309220,EBI-398698 [Q9CQI9<-->Q9D7W5: Med8] NbExp=2 EBI-309220,EBI-7990252 [Q9CQI9<-->Q9NVC6: MED17] Xeno NbExp=2, [Q9CQI9<-->Q15528: MED22] Xeno NbExp=6, [Q9CQI9<-->Q6P2C8: MED27] Xeno NbExp=2, [Q9CQI9<-->Q9H204: MED28] Xeno NbExp=2, [Q9CQI9<-->Q9NX70: MED29] Xeno NbExp=2, |
Repeats | >MDP31668 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.58| 21| 69| 77| 97| 1 --------------------------------------------------------------------------- 77- 97 (35.66/17.80) KLQDHLRQLSILFRKLR.LVYD 148- 169 (32.91/16.08) KLKQKNQQLKQIMDQLRnLIWD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab