Description | Isoform 2 of Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 143 |
Position | Head |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.608 |
Instability index | 44.15 |
Isoelectric point | 8.45 |
Molecular weight | 20277.02 |
Publications | PubMed=11909976 PubMed=16421571 PubMed=15489334 PubMed=12584197 PubMed=15175163 PubMed=15989967 PubMed=16595664 PubMed=18691976 PubMed=19413330 PubMed=19369195 PubMed=21406692 PubMed=22814378 PubMed=23186163 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000269 PubMed:11909976 ECO:0000269 PubMed:16595664 |
GO - Cellular Component | mediator complex GO:0016592 IDA:UniProtKB nucleoplasm GO:0005654 TAS:Reactome nucleus GO:0005634 IDA:UniProtKB ubiquitin ligase complex GO:0000151 IEA:Ensembl |
GO - Biological Function | nuclear receptor coactivator activity GO:0030374 NAS:UniProtKB thyroid hormone receptor binding GO:0046966 IDA:UniProtKB transcription coactivator activity GO:0003713 IDA:UniProtKB transcription coregulator activity GO:0003712 IDA:UniProtKB ubiquitin protein ligase activity GO:0061630 IEA:Ensembl vitamin D receptor binding GO:0042809 NAS:UniProtKB |
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IDA:UniProtKB positive regulation of transcription, DNA-templated GO:0045893 IDA:UniProtKB regulation of transcription initiation from RNA polymerase II promoter GO:0060260 TAS:Reactome stem cell population maintenance GO:0019827 IEA:Ensembl |
Binary Interactions | [Q96HR3<-->Q8NF50-2: DOCK8] NbExp=3 EBI-394659,EBI-10174653 [Q96HR3<-->O14964: HGS] NbExp=5 EBI-394659,EBI-740220 [Q96HR3<-->P42858: HTT] NbExp=3 EBI-394659,EBI-466029 [Q96HR3<-->Q8IY31-3: IFT20] NbExp=3 EBI-394659,EBI-9091197 [Q96HR3<-->P60411: KRTAP10-9] NbExp=3 EBI-394659,EBI-10172052 [Q96HR3<-->Q9H204: MED28] NbExp=6 EBI-394659,EBI-514199 [Q96HR3<-->Q9ULW6: NAP1L2] NbExp=3 EBI-394659,EBI-3911716 [Q96HR3<-->Q9Y5B8: NME7] NbExp=5 EBI-394659,EBI-744782 |
Repeats | >MDP31667 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.90| 21| 69| 77| 97| 1 --------------------------------------------------------------------------- 77- 97 (34.99/17.58) KLQDNLRQLSVLFRKLR.LVYD 148- 169 (32.90/16.25) KLKQKNQQLKQIMDQLRnLIWD --------------------------------------------------------------------------- |
Disease |
MoRF Sequence | Start | Stop |
NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab