<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31666
Description |
Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MWKYGQNQGNQGPAGGGGGAPNMMPMGGFMQGGGGMQGGGGMQHGNMPQMHMTPQQQQQQQQMNMMGGPGGMQMNPNAVGPTGLMPGMSPQHQMQQQQQMMQGVPMSMPPQQAMQQQMMGPQQGLGMGGSSGPQQQQQLQQQQQQSNLQQQQQQHNVGSGGAPGAGGVGNNMLAISQPNPHKEINIVQLSRLGQETVQDIASRFQEVFSALKNIQPTSHRDNNTEKKVQEYFRTIRLLFKRVRIIYDKCNDAVMDYMNAESLIPYKDEPEPRIETSQCDEYRKVLQENHEYIETVKLKNRQLREIIDRTRIIIWEINTMLAMRRS |
Length | 325 |
Position | Head |
Organism | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.883 |
Instability index | 71.17 |
Isoelectric point | 8.85 |
Molecular weight | 36308.90 |
Publications | PubMed=15632085
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 ISS:UniProtKB
|
GO - Biological Function | transcription coregulator activity GO:0003712 ISS:UniProtKB
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 ISS:UniProtKB
|
Interaction
Repeat regions
Repeats |
>MDP31666
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 177.50| 34| 37| 54| 88| 1
---------------------------------------------------------------------------
5- 39 (56.64/11.99) GQNQGNQGPAGGGGGAPNM..mPMGGFMQGGGGMQGG
40- 68 (53.80/10.98) GGMQ........HGNMPQMhmtPQQQQQQQQMNMMGG
70- 104 (67.06/18.24) GGMQMNPNAVGPTGLMPGM..sPQHQMQQQQQMMQGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.02| 17| 31| 111| 129| 3
---------------------------------------------------------------------------
111- 129 (29.56/15.60) QQA.MQQQmmGPQQGLGMGG
144- 161 (28.45/ 9.36) QQSnLQQQ..QQQHNVGSGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 116.52| 24| 27| 228| 251| 4
---------------------------------------------------------------------------
200- 223 (30.16/18.24) IASRFQEVFSA.LK...NIQPTSHRDNN
228- 251 (37.84/24.39) VQEYFRTIRLL.FK...RVRIIYDKCND
253- 280 (24.77/13.93) VMDYMNAESLIpYKdepEPRIETSQCDE
288- 308 (23.74/13.10) NHEYIETVKLK.NR...QLREIIDR...
---------------------------------------------------------------------------
|