<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31666

Description Mediator of RNA polymerase II transcription subunit 30
SequenceMWKYGQNQGNQGPAGGGGGAPNMMPMGGFMQGGGGMQGGGGMQHGNMPQMHMTPQQQQQQQQMNMMGGPGGMQMNPNAVGPTGLMPGMSPQHQMQQQQQMMQGVPMSMPPQQAMQQQMMGPQQGLGMGGSSGPQQQQQLQQQQQQSNLQQQQQQHNVGSGGAPGAGGVGNNMLAISQPNPHKEINIVQLSRLGQETVQDIASRFQEVFSALKNIQPTSHRDNNTEKKVQEYFRTIRLLFKRVRIIYDKCNDAVMDYMNAESLIPYKDEPEPRIETSQCDEYRKVLQENHEYIETVKLKNRQLREIIDRTRIIIWEINTMLAMRRS
Length325
PositionHead
OrganismDrosophila pseudoobscura pseudoobscura (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.04
Grand average of hydropathy-0.883
Instability index71.17
Isoelectric point8.85
Molecular weight36308.90
Publications
PubMed=15632085

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).
GO - Cellular Component
mediator complex	GO:0016592	ISS:UniProtKB
GO - Biological Function
transcription coregulator activity	GO:0003712	ISS:UniProtKB
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	ISS:UniProtKB

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31666
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     177.50|      34|      37|      54|      88|       1
---------------------------------------------------------------------------
    5-   39 (56.64/11.99)	GQNQGNQGPAGGGGGAPNM..mPMGGFMQGGGGMQGG
   40-   68 (53.80/10.98)	GGMQ........HGNMPQMhmtPQQQQQQQQMNMMGG
   70-  104 (67.06/18.24)	GGMQMNPNAVGPTGLMPGM..sPQHQMQQQQQMMQGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.02|      17|      31|     111|     129|       3
---------------------------------------------------------------------------
  111-  129 (29.56/15.60)	QQA.MQQQmmGPQQGLGMGG
  144-  161 (28.45/ 9.36)	QQSnLQQQ..QQQHNVGSGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     116.52|      24|      27|     228|     251|       4
---------------------------------------------------------------------------
  200-  223 (30.16/18.24)	IASRFQEVFSA.LK...NIQPTSHRDNN
  228-  251 (37.84/24.39)	VQEYFRTIRLL.FK...RVRIIYDKCND
  253-  280 (24.77/13.93)	VMDYMNAESLIpYKdepEPRIETSQCDE
  288-  308 (23.74/13.10)	NHEYIETVKLK.NR...QLREIIDR...
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31666 with Med30 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MWKYGQNQGNQGPAGGGGGAPNMMPMGGFMQGGGGMQGGGGMQHGNMPQMHMTPQQQQQQQQMNMMGGPGGMQMNPNAVGPTGLMPGMSPQHQMQQQQQMMQGVPMSMPPQQAMQQQMMGPQQGLGMGGSSGPQQQQQLQQQQQQSNLQQQQQQHNVGSGGAPGAGGVGNNMLAISQPNPHKEINIVQLS
1
190

Molecular Recognition Features

MoRF SequenceStartStop
NANANA