<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31665
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MWKYGQNQGNQGPSSGGGGGGGPNMMPMGGFGMQHGNMQQMHMSPQHQQQQQQMGMMGGPGSMQMNPQGPGGPGGLMPGMSPQHQMQQQQQQQMMQQQMMVPQQGVGVGVGMGGGVGMGGGGVVPQQQQQQPQQNMPQQNIPQQQQQLNPVAGIPPGGAGGSNNMLAISQQNPHKEINIVQLSRLGQETVQDIASRFQEVFASLKGIQPTSHRENSSEKKVQEYFRTIRLLFKRVRIIYEKCNDAGMDYMSAESLIPYRDEPEPRIEPSLCDEYRKVLQENHELIETVKLKNRQLREIIDRTRIIIWEINTMLAMRRS |
| Length | 318 |
| Position | Head |
| Organism | Drosophila melanogaster (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.798 |
| Instability index | 71.11 |
| Isoelectric point | 8.89 |
| Molecular weight | 35300.88 |
| Publications | PubMed=10731132
PubMed=12537572
PubMed=12021283
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IDA:UniProtKB
nucleus GO:0005634 IDA:FlyBase
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IDA:UniProtKB
|
| GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IDA:UniProtKB
|
Interaction
Repeat regions
| Repeats |
>MDP31665
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 117.21| 32| 36| 45| 80| 1
---------------------------------------------------------------------------
45- 80 (61.85/22.54) PQHQ.QQQQQMGMMggPGSMqMNPQ.GPG...GPGGLMpGM
82- 118 (55.36/12.40) PQHQmQQQQQQQMM..QQQM.MVPQqGVGvgvGMGGGV.GM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.22| 20| 100| 16| 40| 2
---------------------------------------------------------------------------
18- 40 (37.53/20.27) GGGGgpnMMPMGGFGMQHGNMQQ
119- 138 (39.69/10.35) GGGG...VVPQQQQQQPQQNMPQ
---------------------------------------------------------------------------
|