<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31665

Description Mediator of RNA polymerase II transcription subunit 30
SequenceMWKYGQNQGNQGPSSGGGGGGGPNMMPMGGFGMQHGNMQQMHMSPQHQQQQQQMGMMGGPGSMQMNPQGPGGPGGLMPGMSPQHQMQQQQQQQMMQQQMMVPQQGVGVGVGMGGGVGMGGGGVVPQQQQQQPQQNMPQQNIPQQQQQLNPVAGIPPGGAGGSNNMLAISQQNPHKEINIVQLSRLGQETVQDIASRFQEVFASLKGIQPTSHRENSSEKKVQEYFRTIRLLFKRVRIIYEKCNDAGMDYMSAESLIPYRDEPEPRIEPSLCDEYRKVLQENHELIETVKLKNRQLREIIDRTRIIIWEINTMLAMRRS
Length318
PositionHead
OrganismDrosophila melanogaster (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.04
Grand average of hydropathy-0.798
Instability index71.11
Isoelectric point8.89
Molecular weight35300.88
Publications
PubMed=10731132
PubMed=12537572
PubMed=12021283

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000269	PubMed:12021283
GO - Cellular Component
mediator complex	GO:0016592	IDA:UniProtKB
nucleus	GO:0005634	IDA:FlyBase
GO - Biological Function
transcription coregulator activity	GO:0003712	IDA:UniProtKB
GO - Biological Process
positive regulation of transcription, DNA-templated	GO:0045893	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IDA:UniProtKB

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31665
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.21|      32|      36|      45|      80|       1
---------------------------------------------------------------------------
   45-   80 (61.85/22.54)	PQHQ.QQQQQMGMMggPGSMqMNPQ.GPG...GPGGLMpGM
   82-  118 (55.36/12.40)	PQHQmQQQQQQQMM..QQQM.MVPQqGVGvgvGMGGGV.GM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.22|      20|     100|      16|      40|       2
---------------------------------------------------------------------------
   18-   40 (37.53/20.27)	GGGGgpnMMPMGGFGMQHGNMQQ
  119-  138 (39.69/10.35)	GGGG...VVPQQQQQQPQQNMPQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31665 with Med30 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MWKYGQNQGNQGPSSGGGGGGGPNMMPMGGFGMQHGNMQQMHMSPQHQQQQQQMGMMGGPGSMQMNPQGPGGPGGLMPGMSPQHQMQQQQQQQMMQQQMMVPQQGVGVGVGMGGGVGMGGGGVVPQQQQQQPQQNMPQQNIPQQQQQLNPVAGIPPGGAGGSNNMLAISQQNP
1
173

Molecular Recognition Features

MoRF SequenceStartStop
1) MWKYGQ
1
6