| Description | Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKDDRAGPPRFASEERREIAEVNKFQVNSKGTQPYLHMYPFSSKLPSHSGCRIPLSRIPCAVQNSNRRINS |
| Length | 193 |
| Position | Head |
| Organism | Bos taurus (Bovine) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae> Bovinae> Bos. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.554 |
| Instability index | 46.90 |
| Isoelectric point | 8.85 |
| Molecular weight | 21690.48 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl transcription coactivator activity GO:0003713 IEA:Ensembl transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central stem cell population maintenance GO:0019827 IEA:Ensembl |
| Binary Interactions |
| Repeats | >MDP31663 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) PYLHMYPFS 2) RIPLSRI | 156 174 | 164 180 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab