Description | Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKDDRAGPPRFASEERREIAEVNKFQVNSKGTQPYLHMYPFSSKLPSHSGCRIPLSRIPCAVQNSNRRINS |
Length | 193 |
Position | Head |
Organism | Bos taurus (Bovine) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae> Bovinae> Bos. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.554 |
Instability index | 46.90 |
Isoelectric point | 8.85 |
Molecular weight | 21690.48 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl transcription coactivator activity GO:0003713 IEA:Ensembl transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central stem cell population maintenance GO:0019827 IEA:Ensembl |
Binary Interactions |
Repeats | >MDP31663 No repeats found |
MoRF Sequence | Start | Stop |
1) PYLHMYPFS 2) RIPLSRI | 156 174 | 164 180 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab