<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31661
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MSGQYPSGYQSPSGHRGNFNSPMMQQQLNQMGVPNQMGMMGFNQGNVMQNQQQMQSGGVQSGPDIGMGQNIQQQQQPNPSQGTGQGQQQQPGQGQAQGQQQQNPQQSPQLGMAAGGQAVSSAAQSATGTVGGAPPGQPNAGPVASTQAASNVQQKEFNLLTLCRIGQETVQDIVSRFQEVFGLLRGIQPPNGTNAGLSSSNDKKAKVQEQFRTIRLLFKRLRLLYDKCNDNCQQGMEYTHVESLIPLKGEPERAEPIHTEEYKKALQENRELIEIVMLKNKQLREIIDKIRLTIWEINTMLSMRRC |
| Length | 306 |
| Position | Head |
| Organism | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.781 |
| Instability index | 55.46 |
| Isoelectric point | 8.90 |
| Molecular weight | 33621.47 |
| Publications | PubMed=17510324
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31661
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.25| 19| 27| 62| 88| 1
---------------------------------------------------------------------------
57- 77 (30.61/12.97) GGV....QsGPDIGMGQNiQQQQQP
81- 104 (25.64/ 9.61) QGTgqgqQqQPGQGQAQG.QQQQNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.79| 17| 21| 14| 31| 2
---------------------------------------------------------------------------
14- 31 (29.85/14.33) GHRGnFNSPMMQQQLNQM
38- 54 (33.94/13.07) GMMG.FNQGNVMQNQQQM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.04| 32| 48| 110| 144| 3
---------------------------------------------------------------------------
110- 141 (57.29/30.74) LGMAAGGQA....VSSAAQSATGTVGG.APPGQPNAG
160- 196 (48.75/19.25) LTLCRIGQEtvqdIVSRFQEVFGLLRGiQPPNGTNAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.98| 24| 59| 203| 227| 4
---------------------------------------------------------------------------
203- 227 (36.38/34.31) KKAkVQEQFRTIRLLF...KRLRLLYDK
263- 289 (34.60/26.78) KKA.LQENRELIEIVMlknKQLREIIDK
---------------------------------------------------------------------------
|