<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31658
| Description |
Mediator of RNA polymerase II transcription subunit 2 |
| Sequence | MSYKNRLTACFDDILKVSAEMMMQQQLKNVQLDPYMVNGFSAQQQNTLKEKIHMFHGILDDLENMLSKSTYYVDTLANLGKESKRQKELELEKQREQEEEEKKQKLLELERKKKEQEEEEEKKKKQKEEEEKRKKELEEQERKKKEQEEEEKRRRQQEQDGDKQQSMFDGLDFTNADLDTSQPGTSGQNDIKSPTMGAGPQTAGTDKPNTADGPDKTNPPIAAFGLGDSQSGGLYNDLNTMDLSMFSELDGGGFDASGFDTANTSNANATTNSVPNNNNPATNDSNMNNDPTAAINAFDGTAAGNNETLGQGEKLEFDQSNPSAMLGNDINMGDNGEDYLTLNDFNDLNIDWSAAGEGGDLDLNGFNI |
| Length | 368 |
| Position | Tail |
| Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Nakaseomyces>
Nakaseomyces/Candida clade.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.189 |
| Instability index | 50.71 |
| Isoelectric point | 4.44 |
| Molecular weight | 41049.21 |
| Publications | PubMed=15229592
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
cytosol GO:0005829 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP31658
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.49| 17| 17| 89| 105| 1
---------------------------------------------------------------------------
93- 110 (27.78/15.78) KQREQEEEEKKQKlLELE
126- 140 (20.32/ 9.58) .QKE.EEEKRKKE.LEEQ
143- 155 (18.39/ 7.98) KKKEQEEEEKRRR.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 149.28| 37| 37| 259| 295| 2
---------------------------------------------------------------------------
168- 189 (29.57/12.87) ...........................................FDGLDFTNADLDT..........SQPGT...SGQN
196- 219 (36.77/17.86) MGAGPQTAG..................................TDKPNTADG.......P....DKTNP.........
220- 286 (35.52/17.00) ....PIAAFglgdsqsgglyndlntmdlsmfseldgggfdasgFDTANTSNANATTNSVP....NNNNPAT...NDSN
287- 331 (47.42/25.23) MNNDPTAAI................................naFDGTAAGN.NETLGQGEklefDQSNPSAmlgNDIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.33| 11| 19| 335| 346| 3
---------------------------------------------------------------------------
335- 346 (17.27/11.55) NGEDyLTLNDFN
357- 367 (22.07/ 9.98) EGGD.LDLNGFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.35| 15| 17| 25| 39| 4
---------------------------------------------------------------------------
25- 39 (26.38/16.47) QQLKNVQLDPYMVNG
43- 57 (26.98/16.98) QQQNTLKEKIHMFHG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.61| 10| 28| 81| 90| 5
---------------------------------------------------------------------------
81- 90 (15.12/ 8.67) KESKRQKELE
111- 120 (16.49/10.11) RKKKEQEEEE
---------------------------------------------------------------------------
|