<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31658

Description Mediator of RNA polymerase II transcription subunit 2
SequenceMSYKNRLTACFDDILKVSAEMMMQQQLKNVQLDPYMVNGFSAQQQNTLKEKIHMFHGILDDLENMLSKSTYYVDTLANLGKESKRQKELELEKQREQEEEEKKQKLLELERKKKEQEEEEEKKKKQKEEEEKRKKELEEQERKKKEQEEEEKRRRQQEQDGDKQQSMFDGLDFTNADLDTSQPGTSGQNDIKSPTMGAGPQTAGTDKPNTADGPDKTNPPIAAFGLGDSQSGGLYNDLNTMDLSMFSELDGGGFDASGFDTANTSNANATTNSVPNNNNPATNDSNMNNDPTAAINAFDGTAAGNNETLGQGEKLEFDQSNPSAMLGNDINMGDNGEDYLTLNDFNDLNIDWSAAGEGGDLDLNGFNI
Length368
PositionTail
OrganismCandida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Nakaseomyces> Nakaseomyces/Candida clade.
Aromaticity0.05
Grand average of hydropathy-1.189
Instability index50.71
Isoelectric point4.44
Molecular weight41049.21
Publications
PubMed=15229592

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). 
ECO:0000250
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
cytosol	GO:0005829	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:EnsemblFungi
GO - Biological Function
RNA polymerase II repressing transcription factor binding	GO:0001103	IEA:EnsemblFungi
transcription coactivator activity	GO:0003713	IEA:EnsemblFungi
GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly	GO:0051123	IEA:EnsemblFungi

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31658
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      66.49|      17|      17|      89|     105|       1
---------------------------------------------------------------------------
   93-  110 (27.78/15.78)	KQREQEEEEKKQKlLELE
  126-  140 (20.32/ 9.58)	.QKE.EEEKRKKE.LEEQ
  143-  155 (18.39/ 7.98)	KKKEQEEEEKRRR.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     149.28|      37|      37|     259|     295|       2
---------------------------------------------------------------------------
  168-  189 (29.57/12.87)	...........................................FDGLDFTNADLDT..........SQPGT...SGQN
  196-  219 (36.77/17.86)	MGAGPQTAG..................................TDKPNTADG.......P....DKTNP.........
  220-  286 (35.52/17.00)	....PIAAFglgdsqsgglyndlntmdlsmfseldgggfdasgFDTANTSNANATTNSVP....NNNNPAT...NDSN
  287-  331 (47.42/25.23)	MNNDPTAAI................................naFDGTAAGN.NETLGQGEklefDQSNPSAmlgNDIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.33|      11|      19|     335|     346|       3
---------------------------------------------------------------------------
  335-  346 (17.27/11.55)	NGEDyLTLNDFN
  357-  367 (22.07/ 9.98)	EGGD.LDLNGFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.35|      15|      17|      25|      39|       4
---------------------------------------------------------------------------
   25-   39 (26.38/16.47)	QQLKNVQLDPYMVNG
   43-   57 (26.98/16.98)	QQQNTLKEKIHMFHG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.61|      10|      28|      81|      90|       5
---------------------------------------------------------------------------
   81-   90 (15.12/ 8.67)	KESKRQKELE
  111-  120 (16.49/10.11)	RKKKEQEEEE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31658 with Med2 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ESKRQKELELEKQREQEEEEKKQKLLELERKKKEQEEEEEKKKKQKEEEEKRKKELEEQERKKKEQEEEEKRRRQQEQDGDKQQSMFDGLDFTNADLDTSQPGTSGQNDIKSPTMGAGPQTAGTDKPNTADGPDKTNPPIAAFGLGDSQSGGLYNDLNTMDLSMFSELDGGGFDASGFDTANTSNANATTNSVPNNNNPATNDSNMNNDPTAAINAFDGTAAGNNETLGQGEKLEFDQSNPSAMLGNDINMG
82
333










Molecular Recognition Features






MoRF SequenceStartStop




NANANA