<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31657
| Description |
Mediator of RNA polymerase II transcription subunit 2 |
| Sequence | MIKELQGGNMATKFKTDEEMRGDRLTQCLDDIMRASTEMMVQQQLKTIQLNSDVAAGFRKALSKSLGDRVRAFHSILDGVETTLTTASQYLDAVEEAAVKMKQWKQQQEEEQRRKHQAELEKNKRQQEHDAATKAAAAQQLMAQQSPVDLTAPTPTGLASNLDKSNRVGGVKPFSAEFGHLDEMDLSMFGGIDGHGDFSLEDFNMGGNSVPLNGGRPRNMVMADAGGFPARGGMGRGGATAINNGAQEIKTSTNEASTNNRNNDGTGGASNPRISSNYNSAVADHESIGLRVDANGQNTKQSGQQSGAGLNPDDYLTLNDFNDLGIDWNTGENNELDLNDFNI |
| Length | 343 |
| Position | Tail |
| Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.758 |
| Instability index | 35.23 |
| Isoelectric point | 4.92 |
| Molecular weight | 37086.38 |
| Publications | PubMed=15001715
PubMed=23749448
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31657
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 82.24| 16| 17| 307| 322| 1
---------------------------------------------------------------------------
191- 204 (25.40/14.10) GID....GHGDFSLEDFN
307- 322 (29.68/17.68) GAGLN..PDDYLTLNDFN
325- 342 (27.16/15.57) GIDWNtgENNELDLNDFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.91| 16| 16| 103| 118| 2
---------------------------------------------------------------------------
103- 118 (29.70/18.24) QWKQQQEEEQRRKHQA
122- 137 (26.21/15.40) KNKRQQEHDAATKAAA
---------------------------------------------------------------------------
|